PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013899821.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family SBP
Protein Properties Length: 528aa    MW: 51478.6 Da    PI: 6.6426
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013899821.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP110.31.2e-34196272177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv+gC  dls+++eyh+r+k+Ce h k ++++ +++ qrfCqqC+rfh+++efD +krsCr+rL khn+rrrk+ 
  XP_013899821.1 196 VCQVDGCFCDLSTLREYHQRYKICEYHLKVTAIMRDDKPQRFCQQCGRFHSVDEFDGAKRSCRNRLLKHNARRRKRD 272
                     6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.3E-29193258IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.504194271IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.07E-29196273IPR004333Transcription factor, SBP-box
PfamPF031102.5E-29197270IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MAALPPHLQQ LASTVLAHAQ QQLHGSRQHA PRAPPPQPLQ PPGEQRGEHT SREDAPAPAP  60
ATPAVPAAPF GGSAACDGAT AAGAGPAGAG SPGGSSFRYE PAAAGAPADE QPRVKVEACT  120
AEAASPLHAG ALELPTSLGT PRPAGEGDAA DVKDAAAQLG PKQPRAAPLS NGGGTSGGGA  180
APQRAPMRAG WGHKGVCQVD GCFCDLSTLR EYHQRYKICE YHLKVTAIMR DDKPQRFCQQ  240
CGRFHSVDEF DGAKRSCRNR LLKHNARRRK RDPVTGTPLG PAANGAAGGS GARKRRAGSS  300
EGDSEEDEAA RRAWGRGRGG GEEGSPGAGG EGEDNGGSGG GGGGGAWGLD MLALVANEGN  360
GLGAAGAPAA RAGDPAAPNG GTRAMIAAAA AAAASGGGVE SDALQAMLAS MLGRPGGAAM  420
VAAAVGQLSA PEAGAEAGGC RGGPDATPAI GGGGGEAEAN AAAAFAAAGS VRQDGAPLAS  480
LGGGAPAPQA DPAHPNQASS SETKQEVPSA TPAEEGTPTS SGLSGKAP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-231962701084squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013899821.10.0Putative squamosa promoter-binding-like protein19
TrEMBLA0A0D2MJK10.0A0A0D2MJK1_9CHLO; Putative squamosa promoter-binding-like protein19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-25squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]